PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0071s0135.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Whirly
Protein Properties Length: 277aa    MW: 31035 Da    PI: 9.4166
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0071s0135.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly204.11.7e-631012381138
               Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkv 90 
                          s+yk+kaal+v++++p+f+ +dsg+ k++++G++ l++a+a + r+ydW++kq+f+ls+ ev+++++l++k+sceffhdp+++ s+eGkv
  Kaladp0071s0135.1.p 101 SIYKGKAALTVEPRAPEFSLMDSGAYKISKDGFVYLQFAPASGFRQYDWSRKQVFSLSVFEVGSIISLGPKDSCEFFHDPFKGRSDEGKV 190
                          7***************************************************************************************** PP

               Whirly  91 rkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138
                          rk+lkvePlpdGsG+f+nlsv+n l++++es+++P+ kaef+vl s++
  Kaladp0071s0135.1.p 191 RKVLKVEPLPDGSGHFFNLSVQNRLLNVDESIYIPINKAEFTVLVSAM 238
                          ********************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.109.6E-7691260IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544478.63E-7594273IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.7E-58102236IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MANLRVFAPQ FAFRNPRTTS QLHISSYESI TSVNFAQPVR TRATCHSGRT KPYLECMQSE  60
YFEPQRFSSS RRSMERFRSD DDGGGGGSAP SPSTRVYVGY SIYKGKAALT VEPRAPEFSL  120
MDSGAYKISK DGFVYLQFAP ASGFRQYDWS RKQVFSLSVF EVGSIISLGP KDSCEFFHDP  180
FKGRSDEGKV RKVLKVEPLP DGSGHFFNLS VQNRLLNVDE SIYIPINKAE FTVLVSAMKF  240
ILPYLLGWNA FANSIKPEDS LRGNNANASV DFEWSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_D1e-1018627532219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1018627532219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1018627532219p24: plant transcriptional regulator PBF-2
1l3a_A1e-1018627532219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277278.11e-111PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9M9S31e-109WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLD7TND71e-111D7TND7_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g01720.t011e-110(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-107ssDNA-binding transcriptional regulator